HPA023653

TTLL6 antibody from Sigma-Aldrich
FLJ35808
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023653
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023653, RRID:AB_1858446
Product name
Anti-TTLL6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023653
Antibody type
Polyclonal
Antigen
Tubulin polyglutamylase TTLL6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QPMGALLLHPSRRGPAGVVASWTSSPAGRDGGVGI
AGAWYFPRASSQAREMPQCPTLESQEGENSEEKGD
SSKEDPKETV
Storage
-20C
Provider Type Product Number
- No reagents -