SAB1400854

TTLL6 antibody from MilliporeSigma / Merck KGaA
FLJ35808
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
SAB1400854
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-TTLL6 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1400854
Antibody type
Polyclonal
Antigen
TTLL6 (NP_775894.1, a.a. 1-569) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MEGCLGVAVLRKLSTFSAYLEDHSYNVEQIWRDIE
DVIIKTLISAHPIIRHNYHTCFPNHTLNSACFEIL
GFDILLDHKLKPWLLEVNHSPSFSTDSRLDKEVKD
GLLYDTLVLINLESCDKKKVLEEERQRGQFLQQCC
SREMRIEEAKGFRAVQLKKTETYEKENCGGFRLIY
PSLNSEKYEKFFQDNNSLFQNTVASRAREEYARQL
IQELRLKREKKPFQMKKKVEMQGESAGEQVRKKGM
RGWQQKQQQKDKAATQASKQYIQPLTLVSYTPDLL
LSVRGERKNETDSSLNQEAPTEEASSVFPKLTSAK
PFSSLPDLRNINLSSSKLEPSKPNFSIKEAKSASA
VNVFTGTVHLTSVETTPESTTQLSISPKSPPTLAV
TASSEYSGPETDRVVSFKCKKQQTPPHLTQKKMLK
SFLPTKSKSFWESPNTNWTLLKSDMNKPHLISELL
Storage
-20C