HPA020357

TSPAN33 antibody from Sigma-Aldrich
MGC50844, Penumbra
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020357
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020357, RRID:AB_1858410
Product name
Anti-TSPAN33 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020357
Antibody type
Polyclonal
Antigen
Tetraspanin-33 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWS
QNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINT
MCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNL
FL
Storage
-20C
Provider Type Product Number
- No reagents -