Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183207 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SRY (Sex Determining Region Y)-Box 14 (SOX14) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SOX14 antibody: synthetic peptide directed towards the N terminal of human SOX14
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPY
LGDTD PLKAAGLPVG- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Fine mapping of the neurally expressed gene SOX14 to human 3q23, relative to three congenital diseases.
Hargrave M, James K, Nield K, Toomes C, Georgas K, Sullivan T, Verzijl HT, Oley CA, Little M, De Jonghe P, Kwon JM, Kremer H, Dixon MJ, Timmerman V, Yamada T, Koopman P
Human genetics 2000 Apr;106(4):432-9
Human genetics 2000 Apr;106(4):432-9
No comments: Submit comment
No validations: Submit validation data