HPA008726

ZNF132 antibody from Sigma-Aldrich
pHZ-12
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008726
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008726, RRID:AB_1080664
Product name
Anti-ZNF132 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008726
Antibody type
Polyclonal
Antigen
Zinc finger protein 132 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHQGTQSEEKPYTCGACGRDFWLNANLHQHQKEHS
GGKPFRWYKDRDALMKSSKVHLSENPFTCREGGKV
ILGSCDLLQLQAVDSGQKPYSNLGQLPEVCTTQKL
FECSNCGKAFLKSSTLPNHLRTHSE
Storage
-20C
Provider Type Product Number
- No reagents -