Antibody data

Product number
H00001158-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001158-M01A, RRID:AB_1237675
Product name
CKM monoclonal antibody (M01A), clone 3E1-F3
Provider product page
Abnova Corporation - H00001158-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CKM.
Antigen sequence
MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLT
LELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIM
TVGCVAGDEESYEVFKELFDPIISDCHGGYKPTDK
HKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGY
TLPPHCSRGERRAVEKLSVEALNSLAGEFKGKYYP
LKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARD
WPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGN
MKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYV
LTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRL
RLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQV
QLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Isotype
IgG
Antibody clone number
3E1-F3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -