HPA020092

NTMT1 antibody from Atlas Antibodies
AD-003, C9orf32, HOMT1A, METTL11A, NRMT, NRMT1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020092
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020092, RRID:AB_1853831
Product name
Anti-NTMT1
Provider product page
Atlas Antibodies - HPA020092
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TDQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVIL
DDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLP
DEIYHVYS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -