HPA022989

CALCOCO2 antibody from Atlas Antibodies
MGC17318, NDP52
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022989
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022989, RRID:AB_1845914
Product name
Anti-CALCOCO2
Provider product page
Atlas Antibodies - HPA022989
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SINKKLELKVKEQKDYWETELLQLKEQNQKMSSEN
EKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQL
EQLKKENDHLFLSLT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -