HPA023019

CALCOCO2 antibody from Sigma-Aldrich
MGC17318, NDP52
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023019
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023019, RRID:AB_1845915
Product name
Anti-CALCOCO2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023019
Antibody type
Polyclonal
Antigen
Calcium-binding and coiled-coil domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENE
EDILVVTTQGEVEEIEQHNKELCKENQELKDSCIS
LQKQNSD
Storage
-20C
Provider Type Product Number
- No reagents -