H00004245-M08A

MGAT1 antibody from Abnova Corporation
GLCNAC-TI, GLYT1, GNT-1, GnTI, MGAT
No application information provided.

Antibody data

Product number
H00004245-M08A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004245-M08A, RRID:AB_1577234
Product name
MGAT1 monoclonal antibody (M08A), clone 2G4
Provider product page
Abnova Corporation - H00004245-M08A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MGAT1.
Antigen sequence
YLQREAYDRDFLARVYGAPQLQVEKVRTNDRKELG
EVRVQYTGRDSFKAFAKALGVMDDLKSGVPRAGYR
GIVTFQFRGRRVHLAPPLTWEGYDPSWN
Isotype
IgM
Antibody clone number
2G4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -