PAB20348

GRHL1 antibody from Abnova Corporation
LBP-32, MGR, TFCP2L2

Antibody data

Product number
PAB20348
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20348, RRID:AB_10968262
Product name
GRHL1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20348
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant GRHL1.
Antigen sequence
VTVSIATMPTHSIKTETQPHGFAVGIPPAVYHPEP
TERVVVFDRNLNTDQFSSGAQAPNAQRRTPDSTFS
ETFKEGVQEVFFPSDLSLRMPGMNSEDYVFDSVSG
NNFEYTLEASKSLRQKPGDSTMTYLNK
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.