HPA006420

GRHL1 antibody from Sigma-Aldrich
LBP-32, MGR, TFCP2L2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006420
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006420, RRID:AB_1079025
Product name
Anti-GRHL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006420
Antibody type
Polyclonal
Antigen
Grainyhead-like protein 1 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VTVSIATMPTHSIKTETQPHGFAVGIPPAVYHPEP
TERVVVFDRNLNTDQFSSGAQAPNAQRRTPDSTFS
ETFKEGVQEVFFPSDLSLRMPGMNSEDYVFDSVSG
NNFEYTLEASKSLRQKPGDSTMTYLNK
Storage
-20C
Provider Type Product Number
- No reagents -