Antibody data

Product number
PAB21829
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21829, RRID:AB_10963858
Product name
C9orf50 polyclonal antibody
Provider product page
Abnova Corporation - PAB21829
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C9orf50.
Antigen sequence
HSQFTTVRKANQPHGAQVPRLKAALTHNPSGEGSR
PCRQRCPFRVRFADETLQDTTLRYWERRRSVQQSV
IVNQKAALPVASERVFGSVGK
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.