HPA026743

C9orf50 antibody from Sigma-Aldrich
FLJ35803
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026743
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026743, RRID:AB_1845829
Product name
Anti-C9orf50 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026743
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf50 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSQFTTVRKANQPHGAQVPRLKAALTHNPSGEGSR
PCRQRCPFRVRFADETLQDTTLRYWERRRSVQQSV
IVNQKAALPVASERVFGSVGK
Storage
-20C
Provider Type Product Number
- No reagents -