HPA024174

TRIT1 antibody from Sigma-Aldrich
FLJ20061, IPT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024174
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024174, RRID:AB_1858346
Product name
Anti-TRIT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024174
Antibody type
Polyclonal
Antigen
tRNA isopentenyltransferase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEPALEIVQSFIQGHKPTATPIKMPYNEAENKRSY
HLCDLCDRIIIGDREWAAHIKSKSHLNQLKKRRRL
DSDAVNTIESQSVSPDH
Storage
-20C
Provider Type Product Number
- No reagents -