HPA019657

STRIP2 antibody from Sigma-Aldrich
FAM40B, FAR11B, KIAA1170
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019657
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019657, RRID:AB_1848399
Product name
Anti-FAM40B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019657
Antibody type
Polyclonal
Antigen
Protein FAM40B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GFEHLQTLKVQKRAELGLPPLAEDSIQVVKSMRAA
SPPSYTLDLGESQLAPPPSKLRGRRGSRRQLLTKQ
DSLDIY
Storage
-20C
Provider Type Product Number
- No reagents -