Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310018 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ribosomal Protein S29 (RPS29) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RPS29 antibody: synthetic peptide directed towards the N terminal of human RPS29
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
YWSHPRKFGQGSRSCRVCSNRHGLIRKYGLNMCRQ
CFRQY AKDIGFIKLD- Vial size
- 0.1 mg
Submitted references Low content of protein S29 in ribosomes of human lung cancer cell line a549: detected by two-dimensional electrophoresis.
Molecular cloning and characterization of human acid sensing ion channel (ASIC)2 gene promoter.
Zhou ZD, Bao L, Liu DG, Li MQ, Ge YZ, Huang YL, Liu WY
Protein and peptide letters 2003 Feb;10(1):91-7
Protein and peptide letters 2003 Feb;10(1):91-7
Molecular cloning and characterization of human acid sensing ion channel (ASIC)2 gene promoter.
Xia J, Zhou ZH, Bubien JK, Fuller CM, Markert JM, Mapstone TB, Gillespie GY, Benos DJ
Gene 2003 Aug 14;313:91-101
Gene 2003 Aug 14;313:91-101
No comments: Submit comment
No validations: Submit validation data