HPA006421

antibody from Atlas Antibodies

Targeting: EMX1

Antibody data

Submit

Validation data

Product number: HPA006421 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA006421, RRID:AB_1078739
Product name: Anti-EMX1
Antibody type: Polyclonal
Reactivity: Human, Mouse
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQP PHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVP QDGLLLHGPFARKPKRI
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

EMX1 protein structure - HPA006421 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and skeletal muscle tissues using HPA006421 antibody. Corresponding EMX1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of mouse E11 embryonic brain shows moderate nuclear positivity in the developing cortical plate.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate nuclear positivity in cells in a subset of renal tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Sample type: HUMAN