HPA006421

EMX1 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006421
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA006421, RRID:AB_1078739
Product name
Anti-EMX1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA006421
Antibody type
Polyclonal
Antigen
Homeobox protein EMX1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQP
PHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVP
QDGLLLHGPFARKPKRI
Storage
-20C
Provider Type Product Number
- No reagents -