HPA013403

TOR1B antibody from MilliporeSigma / Merck KGaA
DQ1, MGC4386
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013403
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA013403, RRID:AB_1858195
Product name
Anti-TOR1B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA013403
Antibody type
Polyclonal
Antigen
Torsin-1B Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LITKTALDFWRAGRKREDIQLKDLEPVLSVGVFNN
KHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVR
AEMRARGSAIDEDIVTRVAEEMTFFPRDEKIYSDK
GCKTVQSRLDFH
Storage
-20C
Provider Type Product Number
- No reagents -