Antibody data

Product number
H00004899-M01A
Provider
Abnova Corporation
Product name
NRF1 monoclonal antibody (M01A), clone 2F9
Provider product page
Abnova Corporation - H00004899-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NRF1.
Antigen sequence
TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWP
EDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCY
KQHGREDLLYAFEDQ
Isotype
IgG
Antibody clone number
2F9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -