Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004899-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004899-M01, RRID:AB_490012
- Product name
- NRF1 monoclonal antibody (M01), clone 2F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NRF1.
- Antigen sequence
TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWP
EDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCY
KQHGREDLLYAFEDQ- Isotype
- IgG
- Antibody clone number
- 2F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Decreased expression of BRCA1 in SK-BR-3 cells is the result of aberrant activation of the GABP Beta promoter by an NRF-1-containing complex.
Thompson C, MacDonald G, Mueller CR
Molecular cancer 2011 May 24;10:62
Molecular cancer 2011 May 24;10:62
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NRF1 monoclonal antibody (M01), clone 2F9. Western Blot analysis of NRF1 expression in human Skeletal muscle.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NRF1 expression in transfected 293T cell line by NRF1 monoclonal antibody (M01), clone 2F9.Lane 1: NRF1 transfected lysate (Predicted MW: 55.7 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NRF1 monoclonal antibody (M01), clone 2F9. Western Blot analysis of NRF1 expression in HeLa.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NRF1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to NRF1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol