Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309899 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Respiratory Factor 1 (NRF1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NRF1 antibody: synthetic peptide directed towards the C terminal of human NRF1
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
IVLSGETAAAVGALTGVQDANGLFMADRAGRKWIL
TDKAT GLVQIPVSMY- Vial size
- 0.1 mg
Submitted references KIAA0649, a 1A6/DRIM-interacting protein with the oncogenic potential.
A novel function of transcription factor alpha-Pal/NRF-1: increasing neurite outgrowth.
Yang L, Zhao J, Lü W, Li Y, Du X, Ning T, Lu G, Ke Y
Biochemical and biophysical research communications 2005 Sep 2;334(3):884-90
Biochemical and biophysical research communications 2005 Sep 2;334(3):884-90
A novel function of transcription factor alpha-Pal/NRF-1: increasing neurite outgrowth.
Chang WT, Chen HI, Chiou RJ, Chen CY, Huang AM
Biochemical and biophysical research communications 2005 Aug 19;334(1):199-206
Biochemical and biophysical research communications 2005 Aug 19;334(1):199-206
No comments: Submit comment
No validations: Submit validation data