HPA021367

IGF2BP1 antibody from Sigma-Aldrich
IMP-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021367
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021367, RRID:AB_1851480
Product name
Anti-IGF2BP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021367
Antibody type
Polyclonal
Antigen
Insulin-like growth factor 2 mRNA-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPS
SVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGK
K
Storage
-20C
Provider Type Product Number
- No reagents -