HPA021242

C9orf78 antibody from Atlas Antibodies
CSU2, HCA59, HSPC220
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA021242
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021242, RRID:AB_1845838
Product name
Anti-C9orf78
Provider product page
Atlas Antibodies - HPA021242
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MPVVRKIFRRRRGDSESEEDEQDSEEVRLKLEETR
EVQNLRKRPNGVSAVALLVGEKVQEETTLVDDPFQ
MKTGGMVDMKKLKE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -