HPA021216

C9orf78 antibody from Sigma-Aldrich
HCA59, HSPC220
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021216
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021216, RRID:AB_1845836
Product name
Anti-C9orf78 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021216
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf78 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDA
KARLLAEQQNKKKDSETSFVPTNMAVNYVQHNR
Storage
-20C
Provider Type Product Number
- No reagents -