Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501421 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Kv Channel Interacting Protein 2 (KCNIP2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the middle region of human KCNIP2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDS
STYAT FLFNAFDTNH- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references C-terminal domain of Kv4.2 and associated KChIP2 interactions regulate functional expression and gating of Kv4.2.
Han W, Nattel S, Noguchi T, Shrier A
The Journal of biological chemistry 2006 Sep 15;281(37):27134-44
The Journal of biological chemistry 2006 Sep 15;281(37):27134-44
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting