Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183184 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Kv Channel Interacting Protein 2 (KCNIP2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the N terminal of human KCNIP2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKE
LQVLY RGFKNPGALS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Ito channels are octomeric complexes with four subunits of each Kv4.2 and K+ channel-interacting protein 2.
Kim LA, Furst J, Butler MH, Xu S, Grigorieff N, Goldstein SA
The Journal of biological chemistry 2004 Feb 13;279(7):5549-54
The Journal of biological chemistry 2004 Feb 13;279(7):5549-54
No comments: Submit comment
No validations: Submit validation data