HPA007267

PGBD1 antibody from Sigma-Aldrich
dJ874C20.4, HUCEP-4, SCAND4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007267
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007267, RRID:AB_1079601
Product name
Anti-PGBD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007267
Antibody type
Polyclonal
Antigen
piggyBac transposable element derived 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PCVKTYPLESGEEAVTVLENLETGSGDTGQQASVY
IQGQDMHPMVAEYQGVSLECQSLQLLPGITTLKCE
PPQRPQGNPQEVSGPVPHGSAHLQEKNPRDKAVVP
VFNPVRSQTLVKTEEETAQAVAAEKWSHLSLTRRN
LCGNS
Storage
-20C
Provider Type Product Number
- No reagents -