H00004610-B01P

MYCL antibody from Abnova Corporation
bHLHe38, LMYC, MYCL1

Antibody data

Product number
H00004610-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004610-B01P, RRID:AB_10553505
Product name
MYCL1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00004610-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MYCL1 protein.
Antigen sequence
MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFEL
VPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTG
DEAESRGHSKGWGRNYASIIRRDCMWSGFSARERL
ERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNP
APAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKR
GPPHGWPKLCPCLRSGIGSSQALGPSPPLFG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -