HPA019089

ZC3HC1 antibody from Sigma-Aldrich
NIPA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019089
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019089, RRID:AB_1858976
Product name
Anti-ZC3HC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019089
Antibody type
Polyclonal
Antigen
Nuclear-interacting partner of ALK recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CEGQAFAVGVEKNWGAVVRSPEGTPQKIRQLIDEG
IAPEEGGVDAKDTSATSQSVNGSPQAEQPSLESTS
KEAFFSRVETFSSLKWAGKPFELSPLVCAKYGWV
Storage
-20C
Provider Type Product Number
- No reagents -