HPA008228

CBX4 antibody from Atlas Antibodies
hPC2, NBP16, PC2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008228
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008228, RRID:AB_1078413
Product name
Anti-CBX4
Provider product page
Atlas Antibodies - HPA008228
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQV
KPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAE
SLSEFKPFFGNIIITDVTANCLTVTFKEYVTV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -