HPA008228

CBX4 antibody from Sigma-Aldrich
hPC2, NBP16, PC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008228
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008228, RRID:AB_1078413
Product name
Anti-CBX4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008228
Antibody type
Polyclonal
Antigen
E3 SUMO-protein ligase CBX4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQV
KPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAE
SLSEFKPFFGNIIITDVTANCLTVTFKEYVTV
Storage
-20C
Provider Type Product Number
- No reagents -