HPA024204

TRIM41 antibody from Atlas Antibodies
MGC1127, RINCK
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024204
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024204, RRID:AB_1858299
Product name
Anti-TRIM41
Provider product page
Atlas Antibodies - HPA024204
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RESTHHKEKVGPGGSSVGSGDASSSRHHHRRRRLH
LPQQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPS
EKPRRFGVYLDYEA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -