HPA024204

TRIM41 antibody from Sigma-Aldrich
MGC1127, RINCK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024204
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024204, RRID:AB_1858299
Product name
Anti-TRIM41 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024204
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 41 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RESTHHKEKVGPGGSSVGSGDASSSRHHHRRRRLH
LPQQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPS
EKPRRFGVYLDYEA
Storage
-20C
Provider Type Product Number
- No reagents -