HPA021004

MYBPC1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021004
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021004, RRID:AB_1854232
Product name
Anti-MYBPC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021004
Antibody type
Polyclonal
Antigen
Myosin-binding protein C, slow-type recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTV
KVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLAS
KAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGN
YRCEVTYKDKFDSCSFDLEVHESTGTTPN
Storage
-20C
Provider Type Product Number
- No reagents -