HPA020119

KLHDC10 antibody from Atlas Antibodies
KIAA0265, slim
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020119
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020119, RRID:AB_2249467
Product name
Anti-KLHDC10
Provider product page
Atlas Antibodies - HPA020119
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGG
GTSWTAYSLNKIHAYNLETNAWEEIATKPHEKIGF
PAARRCHSCVQIK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -