HPA020119

KLHDC10 antibody from Sigma-Aldrich
KIAA0265, slim
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020119
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020119, RRID:AB_2249467
Product name
Anti-KLHDC10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020119
Antibody type
Polyclonal
Antigen
Kelch domain-containing protein 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGG
GTSWTAYSLNKIHAYNLETNAWEEIATKPHEKIGF
PAARRCHSCVQIK
Storage
-20C
Provider Type Product Number
- No reagents -