HPA005800

TBX19 antibody from Sigma-Aldrich
dj747L4.1, TPIT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005800
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005800, RRID:AB_1080219
Product name
Anti-TBX19 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005800
Antibody type
Polyclonal
Antigen
T-box transcription factor TBX19 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALKIKYNPFAKAFLDAKERNHLRDVPEAISESQHV
TYSHLGGWIFSNPDGVCTAGNSNYQYAAPLPLPAP
HTHHGCEHYSG
Storage
-20C
Provider Type Product Number
- No reagents -