HPA021546

PPT1 antibody from Sigma-Aldrich
CLN1, INCL, PPT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021546
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021546, RRID:AB_1855667
Product name
Anti-PPT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021546
Antibody type
Polyclonal
Antigen
Palmitoyl-protein thioesterase 1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPL
QETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLS
EEWFY
Storage
-20C
Provider Type Product Number
- No reagents -