HPA021317

CPA2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021317
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021317, RRID:AB_1846008
Product name
Anti-CPA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021317
Antibody type
Polyclonal
Antigen
Carboxypeptidase A2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LETFVGDQVLEIVPSNEEQIKNLLQLEAQEHLQLD
FWKSPTTPGETAHVRVPFVNVQAVKVFLESQGIAY
SI
Storage
-20C
Provider Type Product Number
- No reagents -