HPA017015

GATAD2B antibody from Sigma-Aldrich
P66beta
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017015
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017015, RRID:AB_1854905
Product name
Anti-GATAD2B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017015
Antibody type
Polyclonal
Antigen
Transcriptional repressor p66-beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNR
TAGRPGKENINDEPVDMSARRSEPERGRLTPSPDI
IVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIE
ERQQLIKQLRDELRLEEARLV
Storage
-20C
Provider Type Product Number
- No reagents -