HPA017015

GATAD2B antibody from Atlas Antibodies
P66beta
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA017015
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017015, RRID:AB_1854905
Product name
Anti-GATAD2B
Provider product page
Atlas Antibodies - HPA017015
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNR
TAGRPGKENINDEPVDMSARRSEPERGRLTPSPDI
IVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIE
ERQQLIKQLRDELRLEEARLV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -