Antibody data

Product number
PAB20445
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20445, RRID:AB_10970278
Product name
TMF1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20445
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant TMF1.
Antigen sequence
TSTTSDIEVLDHESVISESSASSRQETTDSKSSLH
LMQTSFQLLSASACPEYNRLDDFQKLTESCCSSDA
FERIDSFSVQSLDSRSVSEINSDDELSGKGYALVP
IIVNSSTPKSKTVESAEGKSEEVNETLVIPTEEAE
MEESG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -