HPA008729

TMF1 antibody from Sigma-Aldrich
ARA160, TMF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008729
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008729, RRID:AB_1080310
Product name
Anti-TMF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008729
Antibody type
Polyclonal
Antigen
TATA element modulatory factor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSTTSDIEVLDHESVISESSASSRQETTDSKSSLH
LMQTSFQLLSASACPEYNRLDDFQKLTESCCSSDA
FERIDSFSVQSLDSRSVSEINSDDELSGKGYALVP
IIVNSSTPKSKTVESAEGKSEEVNETLVIPTEEAE
MEESG
Storage
-20C
Provider Type Product Number
- No reagents -