HPA021836

CPA1 antibody from Sigma-Aldrich
CPA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021836
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021836, RRID:AB_1846005
Product name
Anti-CPA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021836
Antibody type
Polyclonal
Antigen
Carboxypeptidase A1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MIEDVQSLLDEEQEQMFAFRSRARSTDTFNYATYH
TLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIY
VLKF
Storage
-20C
Provider Type Product Number
- No reagents -