Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008861-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008861-M02, RRID:AB_714757
- Product name
- LDB1 monoclonal antibody (M02), clone 2G9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LDB1.
- Antigen sequence
MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRI
FELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTI
TFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYY
VLKHP- Isotype
- IgG
- Antibody clone number
- 2G9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- LDB1 monoclonal antibody (M02), clone 2G9 Western Blot analysis of LDB1 expression in IMR-32 ( Cat # L008V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged LDB1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol