HPA011981

ANKRD30A antibody from Sigma-Aldrich
NY-BR-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011981
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011981, RRID:AB_1844841
Product name
Anti-ANKRD30A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011981
Antibody type
Polyclonal
Antigen
Ankyrin repeat domain-containing protein 30A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KINGKLEESPNKDGLLKATCGMKVSIPTKALELKD
MQTFKAEPPGKPSAFEPATEMQKSVPNKALELKNE
QTLRADEILPSESKQ
Storage
-20C
Provider Type Product Number
- No reagents -