HPA021466

SMAP2 antibody from Sigma-Aldrich
SMAP1L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021466
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021466, RRID:AB_2239737
Product name
Anti-SMAP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021466
Antibody type
Polyclonal
Antigen
Stromal membrane-associated protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASGMVAPMAMPAGYMGGMQASMMGVPNGMMTTQQA
GYMAGMAAMPQTVYGVQPAQQLQWNLTQMTQQMAG
MNFYGANGMMNYGQSMSGGNGQAANQTLSPQMWK
Storage
-20C
Provider Type Product Number
- No reagents -