HPA006474

TAF5 antibody from Atlas Antibodies
TAF2D, TAFII100
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006474
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006474, RRID:AB_1080185
Product name
Anti-TAF5
Provider product page
Atlas Antibodies - HPA006474
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKRE
ANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPK
KKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSD
KLDKIMNMKETTK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -